Measuring and Observing and Testing Equipment

Immunogen testis expressed 38 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen chromosome 11 open reading frame 20 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen testis expressed 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen Synthetic peptide directed towards the C terminal region of human TFAP2A Application Anti-TFAP2A antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 &#956g/ml.

The gene TFAP2A (transcription factor AP-2-&#945) is mapped to human chromosome 6p24.3.

Immunogen transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Transcription factor, TFAP4 (transcription factor AP-4), is a helix-loop-helix (HLH) protein with multiple distinct protein-protein interfaces. Its protein dimerization motif contains leucine repeat elements LR1 and LR2.

TFB2M is a mitochondrial transcription factor that regulates the expression of SERCA2 gene in rat cardiomyocytes. It is also known to induce the transcription of human mtDNA.

Immunogen transcription factor B2, mitochondrial Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to transcription factor B2, mitochondrial Sequence HLLKHCFGRRSATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLED Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Immunogen transcription factor B2, mitochondrial recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Trefoil factor 1 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are