-
HPA061003-100UL
Sigma-Aldrich
Anti-TH antibody produced in rabbit (C15-1463-679)
Price: $928.29List Price: $1,031.43Immunogen tyrosine hydroxylase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA071310-100ULImmunogen THAP domain containing, apoptosis associated protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
HPA064056-100UL
Sigma-Aldrich
Anti-THAP8 antibody produced in rabbit (C15-1464-554)
Price: $928.29List Price: $1,031.43Immunogen THAP domain containing 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA070139-100UL
Sigma-Aldrich
Anti-THAP8 antibody produced in rabbit (C15-1465-794)
Price: $928.29List Price: $1,031.43Immunogen THAP domain containing 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA037420-100UL
Sigma-Aldrich
Anti-THAP9 antibody produced in rabbit (C15-1454-701)
Price: $928.29List Price: $1,031.43Immunogen THAP domain containing 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA037421-100UL
Sigma-Aldrich
Anti-THAP9 antibody produced in rabbit (C15-1454-702)
Price: $928.29List Price: $1,031.43Immunogen THAP domain containing 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA002982-100ULImmunogen Thrombomodulin precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
-
HPA059756-100ULImmunogen thrombospondin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
-
HPA073242-100ULImmunogen Recombinant protein corresponding to thrombospondin 3 Sequence VGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by
-
HPA028161-100ULImmunogen thioesterase superfamily member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA031422-100UL
Sigma-Aldrich
Anti-THEMIS antibody produced in rabbit (C15-1453-112)
Price: $889.20List Price: $988.00Immunogen thymocyte selection associated Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA031425-100UL
Sigma-Aldrich
Anti-THEMIS antibody produced in rabbit (C15-1453-113)
Price: $889.20List Price: $988.00Immunogen thymocyte selection associated recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are