-
HPA041020-100ULImmunogen KIAA1609 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
HPA071396-100ULImmunogen transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the
-
AV32362-100UL
Sigma-Aldrich
Anti-TLE3 antibody produced in rabbit (C15-1340-717)
Price: $759.43List Price: $843.81TLE3 is known to function as a transcriptional coregulator of adipogenesis. It interacts with HESX1 and PROP1 to regulate transcriptional expression. -
HPA054116-100UL
Sigma-Aldrich
Anti-TLE3 antibody produced in rabbit (C15-1461-575)
Price: $928.29List Price: $1,031.43Transducin-like enhancer of split 3 (TLE3) belongs to the groucho family and comprises Q and WD40 domains. The TLE3 gene is mapped to human chromosome locus 15q23. -
HPA065357-100ULImmunogen transducin-like enhancer of split 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
-
HPA016043-100ULImmunogen Serine/threonine-protein kinase tousled-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA060767-100ULImmunogen tolloid-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The
-
HPA004748-100ULTLN1 (talin 1) is a cytoskeletal protein expressed at cell-extracellular matrix. It is generally a high-molecular-weight molecule, widely distributed from molds to humans.
-
HPA066755-100ULImmunogen toll like receptor 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA049174-100ULToll-like receptor 4 (TLR4) is a member of the pattern recognition receptors (PRRs) family. It is expressed on the cell surface of endothelial cells, cardiac myocytes, and central nervous system (CNS).
-
HPA001608-100ULImmunogen Toll-like receptor 8 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA030504-100UL
Sigma-Aldrich
Anti-TLX3 antibody produced in rabbit (C15-1452-727)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to T-cell leukemia homeobox 3 Sequence APFEDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and