-
HPA060957-100UL
Sigma-Aldrich
Anti-TLX3 antibody produced in rabbit (C15-1463-664)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to T-cell leukemia homeobox 3 Sequence PPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
HPA069359-100UL
Sigma-Aldrich
Anti-TLX3 antibody produced in rabbit (C15-1465-664)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to T-cell leukemia homeobox 3 Sequence SRLMLQLQHDAFQKSLNDSIQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA002823-100ULImmunogen Transmembrane 4 L6 family member 1 recombinant protein epitope signature tag (PrEST) Application Anti-TM4SF1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each
-
HPA069378-100ULImmunogen transmembrane 4 L six family member 18 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA059249-100ULImmunogen transmembrane 9 superfamily member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA005657-100ULTransmembrane 9 superfamily member 2 (TM9SF2) is found primarily in endosomes. It has a hydrophilic N-terminal domain and a hydrophobic C-terminal domain which contains nine membrane-spanning domains.
-
HPA039609-100ULImmunogen transmembrane 9 superfamily member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
-
HPA064099-100ULImmunogen transmembrane 9 superfamily protein member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA041571-100UL
Sigma-Aldrich
Anti-TMA16 antibody produced in rabbit (C15-1456-769)
Price: $928.29List Price: $1,031.43Immunogen chromosome 4 open reading frame 43 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA052688-100UL
Sigma-Aldrich
Anti-TMA16 antibody produced in rabbit (C15-1461-104)
Price: $928.29List Price: $1,031.43Immunogen translation machinery associated 16 homolog Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA018507-100ULTEMED1 (transmembrane emp24 domain-containing protein-1) belongs to TMED/p24 family of proteins. TEMED1 is widely expressed.
-
HPA047139-100UL
Sigma-Aldrich
Anti-TMED10 antibody produced in rabbit (C15-1459-143)
Price: $928.29List Price: $1,031.43Immunogen transmembrane emp24-like trafficking protein 10 (yeast) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most