-
Add to Cart The item has been addedHPA040182-100ULSigma-Aldrich
Anti-TPSD1 antibody produced in rabbit (C15-1456-096)
Price: $928.29List Price: $1,031.43Immunogen tryptase delta 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA049554-100ULSigma-Aldrich
Anti-TPSD1 antibody produced in rabbit (C15-1459-999)
Price: $928.29List Price: $1,031.43Immunogen tryptase delta 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA060458-100ULImmunogen tryptase gamma 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA047415-100ULSigma-Aldrich
Anti-TPST1 antibody produced in rabbit (C15-1459-224)
Price: $928.29List Price: $1,031.43Immunogen tyrosylprotein sulfotransferase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA061837-100ULSigma-Aldrich
Anti-TPST1 antibody produced in rabbit (C15-1463-926)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to tyrosylprotein sulfotransferase 1 Sequence PNYGKPDPKIIENTRRVYKGEFQLPDFLKEKPQTEQVE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA021054-100ULThe gene TPST2 (tyrosine sulfotransferase 2) is mapped to human chromosome 22q12.1. -
Add to Cart The item has been addedHPA039437-100ULImmunogen tumor protein, translationally-controlled 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA049690-100ULImmunogen transmembrane phosphatase with tensin homology Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA005487-100ULTPX2 (targeting protein for Xenopus kinesin-like protein 2) is a spindle assembly factor. It is a kinesin-like motor protein, which is directed toward the plus-end of microtubule. -
Add to Cart The item has been addedHPA036261-100ULSigma-Aldrich
Anti-TRAIP antibody produced in rabbit (C15-1454-254)
Price: $928.29List Price: $1,031.43Immunogen TRAF interacting protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA036262-100ULSigma-Aldrich
Anti-TRAIP antibody produced in rabbit (C15-1454-255)
Price: $928.29List Price: $1,031.43Immunogen TRAF interacting protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA005853-100ULSigma-Aldrich
Anti-TRAK1 antibody produced in rabbit (C15-1446-500)
Price: $879.43List Price: $977.14Immunogen Trafficking kinesin-binding protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
