-
Add to Cart The item has been addedAV13104-100ULSigma-Aldrich
Anti-TRHR antibody produced in rabbit (C15-1340-599)
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the middle region of human TRHR Application Anti-TRHR antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml. Biochem/physiol Actions Thyrotropin-releasing -
Add to Cart The item has been addedHPA055162-100ULSigma-Aldrich
Anti-TRHR antibody produced in rabbit (C15-1461-914)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to thyrotropin releasing hormone receptor Sequence ILFLNPIPSDPKENSKTWKNDSTHQNTNLNVNTSNRCFNSTVSSRKQVTK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
Add to Cart The item has been addedHPA053640-100ULImmunogen TP53 regulated inhibitor of apoptosis 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA063982-100ULImmunogen tribbles pseudokinase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA031685-100ULImmunogen tripartite motif-containing 38 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA019356-100ULSigma-Aldrich
Anti-TRIM4 antibody produced in rabbit (C15-1449-288)
Price: $879.43List Price: $977.14TRIM4 (tripartite motif-containing protein 4) belongs to TRIM family of proteins. The protein localizes in the cytoplasm and cytoplasmic bodies. -
Add to Cart The item has been addedHPA029461-100ULSigma-Aldrich
Anti-TRIM4 antibody produced in rabbit (C15-1452-276)
Price: $879.43List Price: $977.14Immunogen tripartite motif-containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA043818-100ULImmunogen tripartite motif containing 40 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA023561-100ULThe gene TRIM8 (tripartite motif containing 8) encodes a RING (really interesting new gene) finger protein that contains a tripartite motif. It spans a length of 551-amino acids. -
Add to Cart The item has been addedHPA041489-100ULImmunogen tripartite motif containing 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA002570-100ULSigma-Aldrich
Anti-TRIP11 antibody produced in rabbit (C15-1445-618)
Price: $879.43List Price: $977.14TRIP11 (thyroid hormone receptor interactor 11) is a cis -Golgi network-associated protein. It is localized at the cis -Golgi network with a molecular mass of 210kDa. -
Add to Cart The item has been addedHPA070684-100ULSigma-Aldrich
Anti-TRIP11 antibody produced in rabbit (C15-1465-889)
Price: $928.29List Price: $1,031.43Immunogen thyroid hormone receptor interactor 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
