-
Add to Cart The item has been addedHPA003044-100ULSigma-Aldrich
Anti-TST antibody produced in rabbit (C15-1445-764)
Price: $879.43List Price: $977.14Immunogen Thiosulfate sulfurtransferase recombinant protein epitope signature tag (PrEST) Sequence RSLLKTYEQVLENLESKRFQLVDSRSQGRFLGTEPEPDAVGLDSGHIRGAVNMPFMDFLTEDGFEKGPEELRALFQTKKVDLSQPLIATCRKGVTACHVALAAYLCGKPDVAVYDGSWSEWFRRAPPESRVSQGKS Application -
Add to Cart The item has been addedHPA003643-100ULSigma-Aldrich
Anti-TST antibody produced in rabbit (C15-1446-037)
Price: $879.43List Price: $977.14Immunogen Thiosulfate sulfurtransferase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA023361-100ULImmunogen GDP-L-fucose synthetase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA006655-100ULTSTD1 (thiosulfate sulfurtransferase (rhodanese)-like domain containing 1) is a highly conserved protein among mammals with a molecular weight of 12.5kDa. -
Add to Cart The item has been addedHPA018113-100ULTau-tubulin kinase 2 (TTBK2) is a serine/threonine kinase expressed in various tissues and it belongs to the casein kinase 1 family. The gene encoding it is localized on human chromosome 15q15. -
Add to Cart The item has been addedHPA036024-100ULImmunogen tetratricopeptide repeat domain 32 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA041608-100ULSigma-Aldrich
Anti-TTC4 antibody produced in rabbit (C15-1456-794)
Price: $928.29List Price: $1,031.43Tetratricopeptide repeat domain 4 (TTC4) is a novel tumor suppressor gene, mapped to human chromosome 1p31. TTC4 belongs to the tetratricopeptide repeat (TPR) family. -
Add to Cart The item has been addedHPA042459-100ULSigma-Aldrich
Anti-TTC4 antibody produced in rabbit (C15-1457-220)
Price: $928.29List Price: $1,031.43Immunogen tetratricopeptide repeat domain 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA055169-100ULImmunogen tetratricopeptide repeat domain 9C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA054837-100ULImmunogen transcription termination factor, RNA polymerase I Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA051413-100ULImmunogen tubulin tyrosine ligase-like family, member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA027091-100ULImmunogen tubulin tyrosine ligase-like family, member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
