-
HPA036178-100UL
Sigma-Aldrich
Anti-UMPS antibody produced in rabbit (C15-1454-220)
Price: $928.29List Price: $1,031.43Immunogen uridine monophosphate synthetase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA036179-100UL
Sigma-Aldrich
Anti-UMPS antibody produced in rabbit (C15-1454-221)
Price: $928.29List Price: $1,031.43Immunogen uridine monophosphate synthetase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA041912-100ULImmunogen unc-119 homolog ( C. elegans ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA077812-100ULImmunogen unc-119 lipid binding chaperone B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
-
HPA039228-100ULImmunogen unc-45 homolog A (C. elegans) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA017861-100ULUnc-45 myosin chaperone B (UNC45B) is a muscle-specific chaperone which is expressed in the heart and skeletal muscles. It has an amino terminus which contains three tetratricopeptide repeat (TPR) motifs, a central region and a carboxyl terminal
-
HPA076687-100ULImmunogen unc-5 netrin receptor B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA015725-100ULImmunogen unc-5 homolog C (C. elegans)-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA071881-100ULImmunogen Recombinant protein corresponding to unc-79 homolog (C. elegans) Sequence SFALPEMSLDDHPDPGTEGEKPGELMPSSGAKTVLLKVPEDAENPTESEKPDTSAESDTEQNPERKVEEDGAEESEFKIQIVPRQRKQRKIAVSA Application All Prestige Antibodies Powered by Atlas Antibodies are
-
HPA042472-100UL
Sigma-Aldrich
Anti-UNC80 antibody produced in rabbit (C15-1457-226)
Price: $928.29List Price: $1,031.43Immunogen unc-80 homolog (C. elegans) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA050959-100UL
Sigma-Aldrich
ANTI-UNC80 ANTIBODY PRODUCED IN RABBIT (C15-1460-473)
Price: $977.14List Price: $1,085.71Immunogen unc-80 homolog, NALCN channel complex subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
AV49929-100ULImmunogen Synthetic peptide directed towards the N terminal region of human UNC84A Application Anti-UNC84A antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.