-
HPA060513-100UL
Sigma-Aldrich
Anti-USP3 antibody produced in rabbit (C15-1463-556)
Price: $928.29List Price: $1,031.43Immunogen ubiquitin specific peptidase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA077975-100UL
Sigma-Aldrich
Anti-USP3 antibody produced in rabbit (C15-1467-119)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to ubiquitin specific peptidase 3 Sequence PFLDLSLDIPSQFRSKRSKNQENGPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA016952-100ULUSP30 (ubiquitin specific peptidase 30) is a deubiquitinating protein localized in the outer membrane of mitochondria. USP30 is encoded by the gene mapped to human chromosome 12q24.
-
HPA044365-100ULImmunogen ubiquitin specific peptidase 32 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA005719-100ULUbiquitin specific peptidase 33 (USP33) belongs to the ubiquitin-specific protease (USP) subclass. It is localized to the cytoplasm, including the endoplasmic reticulum.
-
HPA036990-100ULImmunogen ubiquitin specific peptidase 38 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in
-
AV38825-100UL
Sigma-Aldrich
Anti-USP39 antibody produced in rabbit (C15-1341-132)
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human USP39 Biochem/physiol Actions USP39 is a ubiquitin specific peptidase, a neuronal slicing factor expressed in the brain. It maintains embryonic pituitary homeostasis in -
HPA077350-100UL
Sigma-Aldrich
ANTI-USP39 ANTIBODY PRODUCED IN RABBIT (C15-1467-021)
Price: $977.14List Price: $1,085.71Immunogen ubiquitin specific peptidase 39 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA018499-100ULThe gene USP4 (ubiquitin carboxyl-terminal hydrolase-4) is mapped to human chromosome 3p21.3.
-
HPA005821-100ULImmunogen Ubiquitin carboxyl-terminal hydrolase 40 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA029286-100UL
Sigma-Aldrich
Anti-USP47 antibody produced in rabbit (C15-1452-205)
Price: $879.43List Price: $977.14Immunogen ubiquitin specific peptidase 47 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA029289-100UL
Sigma-Aldrich
Anti-USP47 antibody produced in rabbit (C15-1452-206)
Price: $879.43List Price: $977.14Immunogen ubiquitin specific peptidase 47 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are