-
AV35033-100UL
Anti-ACCN1 antibody produced in rabbit
Price: $819.43List Price: $910.48ACCN1 (or ASIC2) codes for a protein that belongs to the degenerin/epithelial sodium channel (DEG/ENaC) family. ACCN1 may be involved in neurotransmission. -
HPA018873-100UL
Anti-ACCS antibody produced in rabbit (C15-1449-117)
Price: $879.43List Price: $977.14The gene ACCS (1-aminocyclopropane-1-carboxylate synthase-like protein 1) is mapped to human chromosome 11p11.2. -
HPA021654-100UL
Anti-ACCS antibody produced in rabbit (C15-1449-962)
Price: $879.43List Price: $977.14ACCS (1-aminocyclopropane-1-carboxylate synthase-like protein 1) is a member of a-family of PLP (pyridoxal-5′-phosphate)-dependent enzyme family. It is mapped to human chromosome 11p11. -
HPA065042-100UL
ANTI-ACCSL ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen 1-aminocyclopropane-1-carboxylate synthase homolog (inactive) like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
HPA029298-100UL
Anti-ACE antibody produced in rabbit (C15-1452-211)
Price: $879.43List Price: $977.14ACE gene codes for angiotensin-converting enzyme (ACE). It is the main enzyme in the RAS (renin angiotensin system). -
HPA069790-100UL
Anti-ACE antibody produced in rabbit (C15-1465-749)
Price: $928.29List Price: $1,031.43Immunogen angiotensin I converting enzyme Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA070087-100UL
Anti-ACER3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to alkaline ceramidase 3 Sequence DREGYWGPTTSTLDWCEENYSVTWYIAEFWNTVSNLIMIIPPMFGAVQSVRDGLEKR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
ABE18
Anti-acetyl Histone H3 (Lys9) Antibody (C15-1316-954)
Price: $966.86List Price: $1,074.29Histone H3 is one of the five main histone proteins involved in the structure of chromatin in eukaryotic cells. Featuring a main globular domain and a long N-terminal tail, H3 is involved with the structure of the nucleosomes of the ′beads on -
ABE18-S
Anti-acetyl Histone H3 (Lys9) Antibody, Trial Size (C15-1316-956)
Price: $282.86List Price: $314.29Histone H3 is one of the five main histone proteins involved in the structure of chromatin in eukaryotic cells. Featuring a main globular domain and a long N-terminal tail, H3 is involved with the structure of the nucleosomes of the ′beads on -
H9161-200UL
Anti-acetyl- & phospho-Histone H3 (Ac-Lys9, pSer10) antibody produced in rabbit
Price: $1,056.00List Price: $1,173.33Anti-Acetyl & Phospho Histone H3 [Ac-Lys9, pSer10] is developed in rabbit using a synthetic, acetylated and phosphorylated [Ac-Lys, pSer10] histone H3 peptide (amino acids 7-20) corresponding to the N-terminus of human histone H3 conjugated to -
HPA027098-100UL
Anti-ACHE antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen acetylcholinesterase (Yt blood group) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA000657-100UL
Anti-ACIN1 antibody produced in rabbit
Price: $879.43List Price: $977.14ACIN1 (apoptotic chromatin condensation inducer 1) in the nucleus is a protein encoded by the ACIN1 gene in humans. It is also known as Acinus.