-
Add to Cart The item has been addedHPA067323-100ULImmunogen G protein-coupled receptor 171 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA017885-100ULG protein-coupled receptor 179 (GPR179) is a 2367 amino acid orphan G protein receptor. It is expressed in all vertebrates and is part of the glutamate receptor or class C GPCR proteins. -
Add to Cart The item has been addedHPA000161-100ULSigma-Aldrich
Anti-GPRASP1 antibody produced in rabbit (C15-1444-878)
Price: $879.43List Price: $977.14Immunogen G-protein coupled receptor-associated sorting protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA031061-100ULSigma-Aldrich
Anti-GPRASP1 antibody produced in rabbit (C15-1452-958)
Price: $928.29List Price: $1,031.43Immunogen G protein-coupled receptor associated sorting protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA046201-100ULImmunogen growth hormone regulated TBC protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA056417-100ULSigma-Aldrich
Anti-HEBP1 antibody produced in rabbit (C15-1462-337)
Price: $928.29List Price: $1,031.43Immunogen heme binding protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA075277-100ULSigma-Aldrich
Anti-HEBP1 antibody produced in rabbit (C15-1466-707)
Price: $928.29List Price: $1,031.43Immunogen heme binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA016928-100ULHEBP2 ( heme binding protein 2) is a 23kDa haem-binding protein consisting of a single domain with an open distorted open β-barrel and eight anti-parallel strands. Immunogen Heme-binding protein 2 recombinant protein epitope signature tag -
Add to Cart The item has been addedHPA011559-100ULImmunogen Protein HEG homolog 1 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA043768-100ULSigma-Aldrich
Anti-HEPN1 antibody produced in rabbit (C15-1457-863)
Price: $928.29List Price: $1,031.43Immunogen hepatocellular carcinoma, down-regulated 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA063054-100ULSigma-Aldrich
Anti-HEPN1 antibody produced in rabbit (C15-1464-269)
Price: $928.29List Price: $1,031.43Immunogen hepatocellular carcinoma, down-regulated 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA066929-100ULImmunogen Recombinant protein corresponding to hes family bHLH transcription factor 1 Sequence PPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and
