Alpha-1-antichymotrypsin immunological test system

Immunogen matrix AAA peptidase interacting protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to matrix AAA peptidase interacting protein 1 Sequence FAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKNALAANIDEIV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen mitogen-activated protein kinase associated protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen mitogen-activated protein kinase associated protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

MARCH1 (membrane-associated ring finger (C3HC4) 1, E3 ubiquitin protein ligase) is a member of MARCH family of E3 ubiquitin ligases. This family is RING-v type ligases and has 11 members.

Immunogen Complement-activating component of Ra-reactive factor precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen methionyl aminopeptidase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen methionyl aminopeptidase type 1D (mitochondrial) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Methionine aminopeptidase 1D, mitochondrial Precursor (EC 3.4.

Immunogen microfibril associated protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen microfibrillar-associated protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen mitochondria-localized glutamic acid-rich protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive