Alpha-1-antichymotrypsin immunological test system

Immunogen 28S ribosomal protein S22, mitochondrial recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

The gene MRPS23 (mitochondrial ribosomal protein S23) encodes a mitochondrial ribosomal protein. The protein spans a length of 190 amino acids.

Immunogen mitochondrial ribosomal protein S34 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Western Blotting

Immunogen mitochondrial ribosomal protein S6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen 28S ribosomal protein S7, mitochondrial Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

MRPS7 (mitochondrial ribosomal protein S7) encodes for a small subunit mitochondrial ribosomal protein. It binds with the 12S rRNA.

Immunogen non-specific cytotoxic cell receptor protein 1 homolog (zebrafish) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen nucleolar and spindle associated protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to nucleolar and spindle associated protein 1 Sequence THKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQ Application All Prestige Antibodies Powered by Atlas

Immunogen Recombinant protein corresponding to opioid receptor delta 1 Sequence LQPPLFANASDAYPSAFPSAGANASGPP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen Recombinant protein corresponding to opioid receptor kappa 1 Sequence RCFRDFCFPLKMRMERQSTSRVRNTVQDPAYLRDIDGMNKPV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

The gene OPRM1 (opioid receptor &#956 1) is mapped to human chromosome 6q24-q25. The gene spanning a length of 200kb contains 11 exons that yield 17 splice variants.