Alpha-1-antichymotrypsin immunological test system

Immunogen olfactory receptor, family 5, subfamily F, member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

The gene prolyl 4-hydroxylase subunit &#946 (P4HB) is mapped to human chromosome 17q25. It belongs to the family of soluble oxidoreductases.

PACS1 (phosphofurin acidic cluster sorting protein 2) is an intracellular sorting protein. It is expressed in respiratory cilia.

Immunogen Phosphofurin acidic cluster sorting protein 2 recombinant protein epitope signature tag (PrEST) Application Anti-PACS2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project .

Immunogen phosphofurin acidic cluster sorting protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen 3&#8242-phosphoadenosine 5&#8242-phosphosulfate synthase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Poly(ADP-ribose) polymerase 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to prostate and testis expressed 1 Sequence LSGSLSMRNDAVNEIVAVKNNFPVIEIVRCRMCHLQFPGEKCSRGRGICTATTEE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen prostate and testis expressed 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen protein associated with topoisomerase II homolog 1 (yeast) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen PAT1 homolog 1, processing body mRNA decay factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and