-
Add to Cart The item has been addedHPA044516-100ULSigma-Aldrich
Anti-TP73 antibody produced in rabbit (C15-1458-173)
Price: $928.29List Price: $1,031.43Immunogen tumor protein p73 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA044751-100ULSigma-Aldrich
Anti-TPRG1 antibody produced in rabbit (C15-1458-268)
Price: $928.29List Price: $1,031.43Immunogen tumor protein p63 regulated 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA060187-100ULSigma-Aldrich
Anti-TPRG1 antibody produced in rabbit (C15-1463-470)
Price: $928.29List Price: $1,031.43Immunogen tumor protein p63 regulated 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA063163-100ULImmunogen tumor protein p63 regulated 1-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA060458-100ULImmunogen tryptase gamma 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA047415-100ULSigma-Aldrich
Anti-TPST1 antibody produced in rabbit (C15-1459-224)
Price: $928.29List Price: $1,031.43Immunogen tyrosylprotein sulfotransferase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA061837-100ULSigma-Aldrich
Anti-TPST1 antibody produced in rabbit (C15-1463-926)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to tyrosylprotein sulfotransferase 1 Sequence PNYGKPDPKIIENTRRVYKGEFQLPDFLKEKPQTEQVE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA039437-100ULImmunogen tumor protein, translationally-controlled 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA060380-100ULImmunogen trichorhinophalangeal syndrome I Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA006655-100ULTSTD1 (thiosulfate sulfurtransferase (rhodanese)-like domain containing 1) is a highly conserved protein among mammals with a molecular weight of 12.5kDa. -
Add to Cart The item has been addedHPA051426-100ULImmunogen tumor suppressor candidate 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA060582-100ULImmunogen trans-golgi network vesicle protein 23 homolog A (S. cerevisiae) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the
