-
Add to Cart The item has been addedI0282-200ULAnti-alpha-Internexin antibody, Mouse monoclonal
Price: $1,126.29List Price: $1,251.43Monoclonal Anti-α -Internexin (mouse IgG1 isotype) is derived from the 2E3 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from mice immunized with the full-length recombinant rat α -internexin. The gene INA -
Add to Cart The item has been addedHPA026478-100ULAnti-AMPD1 antibody produced in rabbit (C15-1451-069)
Price: $879.43List Price: $977.14The AMPD1 gene is mapped to human chromosome 1p13.2. -
Add to Cart The item has been addedHPA028080-100ULAnti-AMPD1 antibody produced in rabbit (C15-1451-704)
Price: $879.43List Price: $977.14AMPD1 (adenosine monophosphate deaminase 1) encodes the skeletal muscle isoform of myoadenylate deaminase (MAD). It is located on human chromosome 1. -
Add to Cart The item has been addedHPA008718-100ULAnti-ANKHD1 antibody produced in rabbit
Price: $879.43List Price: $977.14ANKHD1 (ankyrin repeat and KH domain containing 1) is a large protein, with a molecular weight of >280kDa. It contains a single KH (K homology) domain and multiple ankyrin repeats. -
Add to Cart The item has been addedHPA002834-100ULAnti-Anti-PTGS1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Prostaglandin G/H synthase 1 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA060945-100ULAnti-AP1S1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 1, sigma 1 subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA066782-100ULAnti-AP1S3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 1, sigma 3 subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA043533-100ULAnti-AP5S1 antibody produced in rabbit (C15-1457-740)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to adaptor related protein complex 5 sigma 1 subunit Sequence ENLLLAEGTLRLLTRLLLDHLRLLAPSTSLLLRADRIEGILTRFLPHGQLLFLNDQFVQGLEKEFSAAW Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA048244-100ULAnti-AP5S1 antibody produced in rabbit (C15-1459-508)
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 5, sigma 1 subunit recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
Add to Cart The item has been addedHPA019206-100ULAnti-AQP1 antibody produced in rabbit
Price: $879.43List Price: $977.14The gene AQP1 (aquaporin-1) is mapped to human chromosome 7p14. It is an integral membrane protein. -
Add to Cart The item has been addedHPA051019-100ULAnti-ARFGAP1 antibody produced in rabbit (C15-1460-495)
Price: $928.29List Price: $1,031.43Immunogen ADP-ribosylation factor GTPase activating protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
Add to Cart The item has been addedHPA056273-100ULAnti-ARFGAP1 antibody produced in rabbit (C15-1462-294)
Price: $928.29List Price: $1,031.43Immunogen ADP-ribosylation factor GTPase activating protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
