Alpha-1-antichymotrypsin immunological test system

Calcineurin homologous protein 1 (CHP1) is a myristoylated EF-hand Ca(2+)-binding protein. Its expression is localized to the plasma membrane, golgi apparatus, and the nucleus.

Immunogen Chordin-like protein 1 precursor recombinant protein epitope signature tag (PrEST) Biochem/physiol Actions Chordin-like protein 1 (CHRDL1) provokes the role of BMP4 by binding to it and inhibiting its interaction with receptors. CHRDL1

Immunogen Chordin-like protein 1 precursor recombinant protein epitope signature tag (PrEST) Application Anti-CHRDL1 antibody produced in rabbit is suitable for immunohistochemistry (formalin-fixed, paraffin-embedded sections). Anti-CHRDL1 antibody

Immunogen Synthetic peptide directed towards the N terminal region of human CHST1 Application Anti-CHST1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25&#956g/ml and for immunohistochemistry of

Immunogen cleavage and polyadenylation factor I subunit 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

The gene CPS1 (carbamoyl-phosphate synthetase I) is mapped to human chromosome 2q35. It is strongly expressed in liver and low levels are present in intestine, kidney and fibroblasts.

Immunogen collapsin response mediator protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen cartilage associated protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen cartilage associated protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

The gene CTBP1 (C-terminal-binding protein 1) is mapped to human chromosome 4p16.3.

Immunogen dullard homolog ( Xenopus laevis ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to CTD nuclear envelope phosphatase 1 Sequence QIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human