-
Add to Cart The item has been addedHPA061763-100ULAnti-HES6 antibody produced in rabbit (C15-1463-902)
Price: $928.29List Price: $1,031.43Immunogen hes family bHLH transcription factor 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA073997-100ULANTI-HES6 ANTIBODY PRODUCED IN RABBIT (C15-1466-479)
Price: $977.14List Price: $1,085.71Immunogen hes family bHLH transcription factor 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA036021-100ULAnti-KAAG1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen kidney associated antigen 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA051333-100ULAnti-MTMR12 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen myotubularin related protein 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedAV48473-100ULAnti-MTR antibody produced in rabbit (C15-1341-697)
Price: $898.29List Price: $998.10MTR codes for 5-methyltetrahydrofolate-homocysteine methyltransferase that catalyzes the last step in methionine synthesis. Genetic alterations in MTR have been associated with methylcobalamin deficiency, breast cancer risk and prostate cancer -
Add to Cart The item has been addedHPA054915-100ULAnti-MTR antibody produced in rabbit (C15-1461-832)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to 5-methyltetrahydrofolate-homocysteine methyltransferase Sequence DIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEMIFVAKEMERLAIRIPLLI Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedHPA006433-100ULAnti-MYRIP antibody produced in rabbit
Price: $879.43List Price: $977.14MYRIP (myosin VIIA and Rab interacting protein) is a Rab27a-interacting protein, and is highly expressed in human umbilical vein endothelial cells (HUVECs). It is localized to mature and peripheral endothelial cell secretory bodies called -
Add to Cart The item has been addedHPA057719-100ULAnti-NEMP2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen nuclear envelope integral membrane protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA058210-100ULAnti-POLE antibody produced in rabbit (C15-1462-865)
Price: $928.29List Price: $1,031.43Immunogen polymerase (DNA directed), epsilon, catalytic subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA067385-100ULAnti-POLE antibody produced in rabbit (C15-1465-286)
Price: $928.29List Price: $1,031.43Immunogen polymerase (DNA directed), epsilon, catalytic subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA005891-100ULAnti-POLR3K antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen DNA-directed RNA polymerases III 12.5 kDa polypeptide recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedAB5308Anti-Presenilin-1 Antibody, loop, a.a. 275-367, CT (C15-1316-213)
Price: $896.57List Price: $996.19Specificity Presenilin-1, Loop. Immunogen Epitope: loop, a.
