-
HPA034757-100UL
Anti-BSN antibody produced in rabbit
Price: $889.20List Price: $988.00Immunogen bassoon (presynaptic cytomatrix protein) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA029190-100UL
Anti-CST9 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen cystatin 9 (testatin) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA036532-100UL
ANTI-DNTT ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen DNA nucleotidylexotransferase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
D9693-200UL
Anti-Doublecortin antibody produced in rabbit
Price: $917.14List Price: $1,019.05Immunogen synthetic peptide corresponding to amino acids 151-170 of human doublecortin, conjugated to KLH. The corresponding sequence is identical in rat and mouse doublecortin. -
HPA055546-100UL
Anti-EPN3 antibody produced in rabbit (C15-1462-047)
Price: $928.29List Price: $1,031.43Immunogen epsin 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA063224-100UL
Anti-EPN3 antibody produced in rabbit (C15-1464-310)
Price: $928.29List Price: $1,031.43Immunogen epsin 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
HPA026900-100UL
Anti-PLN antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Cardiac phospholamban recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA024517-100UL
Anti-SCRN1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Secernin-1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA015825-100UL
Anti-SPEN antibody produced in rabbit (C15-1448-459)
Price: $879.43List Price: $977.14Immunogen Msx2-interacting protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA050257-100UL
Anti-SPEN antibody produced in rabbit (C15-1460-234)
Price: $928.29List Price: $1,031.43Immunogen spen family transcriptional repressor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA046746-100UL
Anti-TICRR antibody produced in rabbit (C15-1458-975)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to TOPBP1 interacting checkpoint and replication regulator Sequence PSKVGKRCRKTSDPRRSIVECQPDASATPGVGTADSPAAPTDSRDDQKGLSLSPQSPPERRGYPGPGLRSDWHASSPLLITSDTEHVTLLSEAEHH Application All Prestige Antibodies -
HPA049454-100UL
Anti-TICRR antibody produced in rabbit (C15-1459-958)
Price: $928.29List Price: $1,031.43Immunogen TOPBP1-interacting checkpoint and replication regulator Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most