Beta-2-glycoprotein iii immunological test system

ERR alpha is a nuclear receptor that is closely related to the estrogen receptor. This protein acts as a site specific transcription regulator and has also been shown to interact with estrogen and the transcription factor TFIIB by direct

Specificity GABAA Receptor beta 1 subunit. The antibody recognizes a protein of ~55 kDa corresponding to GABAA Receptor beta 1 subunit in lysates from rat cerebellum and cortex.

Immunogen glyoxylate reductase 1 homolog (Arabidopsis) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen glyoxylate reductase 1 homolog (Arabidopsis) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

GNRH2 (Gonadotropin-releasing hormone 2) is a 2.1kb protein, highly expressed in the kidney, bone marrow, and prostate.

Immunogen glycerophosphocholine phosphodiesterase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Anti-G s &#945-Subunit, C-Terminal (385-394), rabbit polyclonal, recognizes both large and small forms of G s &#945-subunit. It is validated for use in Western blotting.

Immunogen General transcription factor II-I recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen sphingosine-1-phosphate phosphatase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Recombinant protein corresponding to sphingosine-1-phosphate phosphatase 1. Sequence YPFVDLIDNFNQTHKYAPFI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Solute carrier organic anion transporter family member 2B1 (SLCO2B1) is widely expressed. It is present in liver, placenta, small intestine, kidney, brain, skin, heart, platelets, and skeletal muscle.

Immunogen Recombinant protein corresponding to solute carrier organic anion transporter family member 3A1 Sequence LPEFLTHQYKYEAGEIRWGAEGRDVCAANGSGGDEGPDPDLICRNRTATNM Application All Prestige Antibodies Powered by Atlas Antibodies are developed and