-
Add to Cart The item has been addedHPA068322-100ULAnti-MIB2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen mindbomb E3 ubiquitin protein ligase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAV40567-100ULAnti-PCBP2 (AB2) antibody produced in rabbit
Price: $759.43List Price: $843.81The previously assigned protein identifier Q6IPF4 has been merged into Q15366. Full details can be found on the UniProt database. -
Add to Cart The item has been addedHPA049975-100ULAnti-PFKFB2 antibody produced in rabbit (C15-1460-154)
Price: $928.29List Price: $1,031.43Immunogen 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA063575-100ULAnti-PFKFB2 antibody produced in rabbit (C15-1464-401)
Price: $928.29List Price: $1,031.43Immunogen 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA056716-100ULAnti-PMFBP1 antibody produced in rabbit (C15-1462-428)
Price: $928.29List Price: $1,031.43Immunogen polyamine modulated factor 1 binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA075825-100ULANTI-PMFBP1 ANTIBODY PRODUCED IN RABBIT (C15-1466-780)
Price: $977.14List Price: $1,085.71Immunogen polyamine modulated factor 1 binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA055225-100ULAnti-SPSB2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen splA/ryanodine receptor domain and SOCS box containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedAV34471-100ULAnti-TFB2M (AB1) antibody produced in rabbit
Price: $759.43List Price: $843.81TFB2M is a mitochondrial transcription factor that regulates the expression of SERCA2 gene in rat cardiomyocytes. It is also known to induce the transcription of human mtDNA. -
Add to Cart The item has been addedHPA028482-100ULAnti-TFB2M antibody produced in rabbit (C15-1451-861)
Price: $879.43List Price: $977.14Immunogen transcription factor B2, mitochondrial Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA028554-100ULAnti-TFB2M antibody produced in rabbit (C15-1451-896)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to transcription factor B2, mitochondrial Sequence HLLKHCFGRRSATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLED Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedHPA030265-100ULAnti-TFB2M antibody produced in rabbit (C15-1452-623)
Price: $879.43List Price: $977.14Immunogen transcription factor B2, mitochondrial recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been added475828-1MGbeta₂-Microglobulin, Human, Recombinant, E. coli (C15-1303-829)
Price: $1,747.25List Price: $1,941.39Recombinant, human β 2 -microglobulin fused at the N-terminus to a His•Tag sequence and expressed in E. coli .
