-
Add to Cart The item has been addedHPA045257-100ULAnti-CATSPER4 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen cation channel, sperm associated 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA035134-100ULAnti-CATSPERB antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen cation channel, sperm-associated, beta recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA012388-100ULAnti-ENDOU antibody produced in rabbit (C15-1447-772)
Price: $879.43List Price: $977.14Immunogen Placental protein 11 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA067448-100ULAnti-ENDOU antibody produced in rabbit (C15-1465-304)
Price: $928.29List Price: $1,031.43Immunogen endonuclease, polyU-specific Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA017373-100ULAnti-ITIH3 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Inter-alpha-trypsin inhibitor heavy chain H3 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA063275-100ULAnti-ITLN1 antibody produced in rabbit (C15-1464-322)
Price: $928.29List Price: $1,031.43Omentin (intelectin-1) is highly expressed in omental adipose tissue, small intestine and various other tissues. It is a plasma adipokine made up of 313 amino acids. -
Add to Cart The item has been addedHPA067326-100ULAnti-ITLN1 antibody produced in rabbit (C15-1465-275)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to intelectin 1 Sequence DGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA042250-100ULAnti-TADA3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen transcriptional adaptor 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedAPrEST90251-100PrEST Antigen AGO4 argonaute RISC catalytic component 4, 100
Price: $537.65List Price: $597.39PrEST Antigen AGO4 argonaute RISC catalytic component 4, 100 -
Add to Cart The item has been addedAPREST89930-100ULPrEST Antigen ALYREF
Price: $504.28List Price: $560.31Recombinant protein fragment of Human ALYREF with N-terminal His 6 ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.     Application Blocking agent and positive assay control using -
Add to Cart The item has been addedAPrEST90785-100PrEST Antigen ASXL2 additional sex combs like transcriptiona (C08-0223-223)
Price: $537.65List Price: $597.39PrEST Antigen ASXL2 additional sex combs like transcriptiona -
Add to Cart The item has been addedAPrEST77475-100PrEST Antigen ATF3 activating transcription factor 3, 100ul
Price: $537.65List Price: $597.39PrEST Antigen ATF3 activating transcription factor 3, 100ul
