-
Add to Cart The item has been addedHPA055704-100ULAnti-CHST3 antibody produced in rabbit (C15-1462-098)
Price: $928.29List Price: $1,031.43Immunogen carbohydrate (chondroitin 6) sulfotransferase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been added204903-1MGAnti-Complement 5b-9 Rabbit pAb
Price: $721.46List Price: $801.62Protein A purified rabbit polyclonal antibody. Recognizes the C5b-C9 complement component complex. -
Add to Cart The item has been addedHPA042581-100ULAnti-CSRP3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen cysteine and glycine-rich protein 3 (cardiac LIM protein) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA013143-100ULAnti-CST3 antibody produced in rabbit
Price: $879.43List Price: $977.14Cystatin-C precursor (CST3) belongs to the cystatin family (type2) of proteins and contains 120 amino acids. The gene CST3 is located on human chromosome 20p11. -
Add to Cart The item has been addedHPA030311-100ULAnti-CX3CR1 antibody produced in rabbit (C15-1452-647)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to C-X3-C motif chemokine receptor 1 Sequence KENECLGDYPEVLQEIWPVLRNVETN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA046587-100ULAnti-CX3CR1 antibody produced in rabbit (C15-1458-900)
Price: $928.29List Price: $1,031.43Immunogen chemokine (C-X3-C motif) receptor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA077743-100ULAnti-CX3CR1 antibody produced in rabbit (C15-1467-082)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to C-X3-C motif chemokine receptor 1 Sequence HLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedAV07037-100ULAnti-CXCL3 antibody produced in rabbit
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the middle region of human CXCL3 Application Anti-CXCL3 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml. Biochem/physiol Actions CXCL3 is a chemokine that -
Add to Cart The item has been addedHPA045942-100ULAnti-CXCR3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chemokine (C-X-C motif) receptor 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA064126-100ULAnti-HS3ST3B1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been added855034ANTI-HUMAN COMPLEMENT C4, 2 ML
Price: $536.40List Price: $596.00Lyophilized goat IgG fraction to human complement C4 and buffer salts. -
Add to Cart The item has been addedAB5882-200ULAnti-IP3 Receptor 1 Antibody (C15-1316-387)
Price: $785.14List Price: $872.38Specificity Recognizes IP3 Receptor 1. The epitope does not share homology with any other known proteins.
