-
HPA028825-100UL
Anti-FABP7 antibody produced in rabbit (C15-1452-016)
Price: $879.43List Price: $977.14Immunogen fatty acid binding protein 7, brain recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. -
HPA073619-100UL
Anti-FABP9 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to fatty acid binding protein 9 Sequence ISVDGKMMTIRTESSFQDTKIS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
AV30294-100UL
Anti-FADD (AB2) antibody produced in rabbit
Price: $898.29List Price: $998.10FADD is a death domain-containing protein that associates with fas and mediates apoptosis. Rabbit Anti-FADD (AB2) antibody binds to mouse FADD. -
HPA001464-100UL
Anti-FADD antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Protein FADD recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA043226-100UL
Anti-FAHD1 antibody produced in rabbit (C15-1457-578)
Price: $928.29List Price: $1,031.43Immunogen fumarylacetoacetate hydrolase domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA043534-100UL
Anti-FAHD1 antibody produced in rabbit (C15-1457-741)
Price: $928.29List Price: $1,031.43Immunogen fumarylacetoacetate hydrolase domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA028451-100UL
Anti-FAM102B antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen family with sequence similarity 102, member B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA055888-100UL
Anti-FAM107A antibody produced in rabbit
Price: $928.29List Price: $1,031.43FAM107A (family with sequence similarity 107 member A) is expressed at high level in the brain and heart. It is also known as DRR1, FLJ30158, FLJ45473, TU3A. -
HPA039661-100UL
Anti-FAM107B antibody produced in rabbit (C15-1455-836)
Price: $928.29List Price: $1,031.43Immunogen family with sequence similarity 107, member B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA058814-100UL
Anti-FAM107B antibody produced in rabbit (C15-1463-062)
Price: $928.29List Price: $1,031.43Immunogen family with sequence similarity 107, member B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA073195-100UL
Anti-FAM107B antibody produced in rabbit (C15-1466-328)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to family with sequence similarity 107 member B Sequence LHRELLMNQKRGLAPQNKPELQKVMEKRKRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
HPA000647-100UL
Anti-FAM109B antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Protein FAM109B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the