Immunoglobulin g (fab-specific) test system

Immunogen Protein FAM110B recombinant protein epitope signature tag (PrEST) Sequence KVTSVKPLKAIPCSSSAPPLPPKPKIAAIASMKSPEADPVEPACGVSRRPSLQRSKSDLSDRYFRVDADVERFFNYCGLDPEELENLGMENFARANSDIISLNFRSASMISSDC Application All Prestige Antibodies Powered by

Immunogen Protein FAM110B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

FAM111B (family with sequence similarity 111 member) has a conserved trypsin like cysteine/serine peptidase domain, that is cleaved into two parts and connected by a linker region 41 amino acids in length. This gene is located on human chromosome

FAM117B (family with sequence similarity 117, member B) gene is also called as ALS2CR13 (amyotrophic lateral sclerosis 2 chromosome region, candidate 13). The gene is a transcriptional unit on ALS2 gene that spans a length of 3 Mb and is mapped to

Immunogen family with sequence similarity 117, member B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

FAM120A (Family with sequence similarity 120A) is a novel RNA-binding protein located to chromosome 9q22.31.

Immunogen family with sequence similarity 120A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen family with sequence similarity 120B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen family with sequence similarity 120B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen family with sequence similarity 120C recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen family with sequence similarity 124A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen family with sequence similarity 124B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive