Monkey dander allergenic extracts

Immunogen CCR4-NOT transcription complex, subunit 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen cannabinoid receptor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to DAN domain BMP antagonist family member 5 Sequence GMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA Application All Prestige Antibodies Powered by Atlas

Immunogen DAN domain family, member 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen endothelin 1 recombinant protein epitope signature tag (PrEST) Features and Benefits Prestige Antibodies &#174 are highly characterized and extensively validated antibodies with the added benefit of all available characterization data

The gene electron transfer flavoprotein subunit &#945 (ETFA) is mapped to human chromosome 15q23. The protein localizes in the mitochondria.

The gene electron transfer flavoprotein subunit &#945 (ETFA) is mapped to human chromosome 15q23. The protein localizes in the mitochondria.

The gene electron transfer flavoprotein subunit &#945 (ETFA) is mapped to human chromosome 15q23. The protein localizes in the mitochondria.

Immunogen Electron transfer flavoprotein subunit alpha, mitochondrial Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen chromosome 3 open reading frame 37 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen lin-37 DREAM MuvB core complex component Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen lin-37 DREAM MuvB core complex component Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive