-
HPA051398-100UL
Anti-CNOT8 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen CCR4-NOT transcription complex, subunit 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA069945-100UL
ANTI-CNR1 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen cannabinoid receptor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA043493-100UL
Anti-DAND5 antibody produced in rabbit (C15-1457-717)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to DAN domain BMP antagonist family member 5 Sequence GMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA Application All Prestige Antibodies Powered by Atlas -
HPA049472-100UL
Anti-DAND5 antibody produced in rabbit (C15-1459-966)
Price: $928.29List Price: $1,031.43Immunogen DAN domain family, member 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA031976-100UL
Anti-EDN1 antibody produced in rabbit
Price: $889.20List Price: $988.00Immunogen endothelin 1 recombinant protein epitope signature tag (PrEST) Features and Benefits Prestige Antibodies ® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data -
HPA018990-100UL
Anti-ETFA antibody produced in rabbit (C15-1449-153)
Price: $879.43List Price: $977.14The gene electron transfer flavoprotein subunit α (ETFA) is mapped to human chromosome 15q23. The protein localizes in the mitochondria. -
HPA018993-100UL
Anti-ETFA antibody produced in rabbit (C15-1449-157)
Price: $879.43List Price: $977.14The gene electron transfer flavoprotein subunit α (ETFA) is mapped to human chromosome 15q23. The protein localizes in the mitochondria. -
HPA018996-100UL
Anti-ETFA antibody produced in rabbit (C15-1449-159)
Price: $879.43List Price: $977.14The gene electron transfer flavoprotein subunit α (ETFA) is mapped to human chromosome 15q23. The protein localizes in the mitochondria. -
HPA024089-100UL
Anti-ETFA antibody produced in rabbit (C15-1450-626)
Price: $879.43List Price: $977.14Immunogen Electron transfer flavoprotein subunit alpha, mitochondrial Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
HPA044968-100UL
Anti-HMCES antibody produced in rabbit
Price: $977.14List Price: $1,085.71Immunogen chromosome 3 open reading frame 37 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA043253-100UL
Anti-LIN37 antibody produced in rabbit (C15-1457-598)
Price: $928.29List Price: $1,031.43Immunogen lin-37 DREAM MuvB core complex component Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA047809-100UL
Anti-LIN37 antibody produced in rabbit (C15-1459-341)
Price: $928.29List Price: $1,031.43Immunogen lin-37 DREAM MuvB core complex component Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive