-
Add to Cart The item has been addedHPA027380-100ULAnti-OXR1 antibody produced in rabbit (C15-1451-464)
Price: $879.43List Price: $977.14Immunogen oxidation resistance 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA027395-100ULAnti-OXR1 antibody produced in rabbit (C15-1451-468)
Price: $879.43List Price: $977.14Immunogen oxidation resistance 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA021293-100ULAnti-OXSM antibody produced in rabbit (C15-1449-819)
Price: $879.43List Price: $977.14OXSM (β-ketoacyl-ACP synthase) localizes in the mitochondria. OXSM transcripts are strongly expressed in the heart and skeletal muscle, liver and kidney. -
Add to Cart The item has been addedHPA021300-100ULAnti-OXSM antibody produced in rabbit (C15-1449-822)
Price: $879.43List Price: $977.14OXSM (β-ketoacyl-ACP synthase) localizes in the mitochondria. OXSM transcripts are strongly expressed in the heart and skeletal muscle, liver and kidney. -
Add to Cart The item has been addedHPA021337-100ULAnti-OXSM antibody produced in rabbit (C15-1449-839)
Price: $879.43List Price: $977.14OXSM (β-ketoacyl-ACP synthase) localizes in the mitochondria. OXSM transcripts are strongly expressed in the heart and skeletal muscle, liver and kidney. -
Add to Cart The item has been addedHPA071892-100ULAnti-OXT antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to oxytocin/neurophysin I prepropeptide Sequence ICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedHPA064621-100ULAnti-SOWAHA antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen sosondowah ankyrin repeat domain family member A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA045891-100ULAnti-YEATS2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen YEATS domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedAV30118-100ULAnti-YEATS4 antibody produced in rabbit (C15-1340-612)
Price: $898.29List Price: $998.10YEATS4 is an oncogene that negatively regulates the p21-p53 pathway. Amplification of YEATS4 has been linked to the pathogenesis of non-small cell lung cancers (NSCLC). -
Add to Cart The item has been addedHPA072532-100ULAnti-YEATS4 antibody produced in rabbit (C15-1466-227)
Price: $928.29List Price: $1,031.43Immunogen YEATS domain containing 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedA00098Goat Anti-Rabbit IgG Antibody (H and L) (HRP), pAb,1mg
Price: $178.18List Price: $197.98Goat Anti-Rabbit IgG (H&L) [HRP] Polyclonal Antibody conjugated to horseradish peroxidase. It reacts with rabbit IgG heavy and light chains. -
Add to Cart The item has been addedAPREST90113-100ULPrEST Antigen OAT (C15-1336-115)
Price: $504.28List Price: $560.31Recombinant protein fragment of Human OAT with N-terminal His 6 ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.     Application Blocking agent and positive assay control using
