Protein s-100 b tests

S100A4, also known as Fibroblast-specific Protein 1, is a member of the Ca2+- dependent S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 is a metastasis factor that may function in motility, invasion, and tubulin

4-hydroxy-3-methylbut-2-enyl diphosphate reductase (UniProt: P62623 also known as EC:1.17.

4-hydroxy-3-methylbut-2-enyl diphosphate reductase (UniProt: P62623 also known as EC:1.17.

HSD17B10 (hydroxysteroid (17-b) dehydrogenase 10) gene encodes a mitochondrial, multifunctional protein, 17&#946-hydroxysteroid dehydrogenase type 10. It is a homotetrameric protein belonging to the short-chain dehydrogenase/reductase superfamily.

The gene HSD17B14 (17-&#946-hydroxysteroid dehydrogenase 14) is mapped to human chromosome 19q13.33.

HSD17B2 (Hydroxysteroid 17-&#946 dehydrogenase 2) is a member of the short chain alcohol dehydrogenase superfamily, expressed in non-steroidogenic human embryonic kidney cells. Immunogen hydroxysteroid (17-beta) dehydrogenase 2 recombinant protein

Immunogen hydroxysteroid (17-beta) dehydrogenase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Endoplasmin precursor recombinant protein epitope signature tag (PrEST) Sequence SGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETAEDTTEDTEQDEDEEMDVGTDEEEETAKESTA Application

Immunogen Endoplasmin precursor recombinant protein epitope signature tag (PrEST) Sequence WSSKTETVEEPMEEEEAAKEEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTS Application All Prestige Antibodies Powered

Immunogen heat shock protein family B (small), member 11 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen heat shock protein family B (small) member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen LSM10, U7 small nuclear RNA associated recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,