-
Add to Cart The item has been addedHPA067842-100ULAnti-SNRPB antibody produced in rabbit (C15-1465-379)
Price: $928.29List Price: $1,031.43Immunogen small nuclear ribonucleoprotein polypeptides B and B1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA050814-100ULAnti-SNRPB2 antibody produced in rabbit (C15-1460-421)
Price: $928.29List Price: $1,031.43Immunogen small nuclear ribonucleoprotein polypeptide B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA076104-100ULAnti-SNRPB2 antibody produced in rabbit (C15-1466-830)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to small nuclear ribonucleoprotein polypeptide B2 Sequence AKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
Add to Cart The item has been addedHPA042419-100ULAnti-SNRPC antibody produced in rabbit (C15-1457-201)
Price: $928.29List Price: $1,031.43Immunogen small nuclear ribonucleoprotein polypeptide C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA055490-100ULAnti-SNRPC antibody produced in rabbit (C15-1462-035)
Price: $928.29List Price: $1,031.43Immunogen small nuclear ribonucleoprotein polypeptide C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA024730-100ULAnti-SNX16 antibody produced in rabbit (C15-1450-869)
Price: $879.43List Price: $977.14The gene SNX16 (sorting nexin 16) is mapped to human chromosome 8q21.13. -
Add to Cart The item has been addedHPA024731-100ULAnti-SNX16 antibody produced in rabbit (C15-1450-870)
Price: $879.43List Price: $977.14The gene SNX16 (sorting nexin 16) is mapped to human chromosome 8q21.13. -
Add to Cart The item has been addedHPA024817-100ULAnti-SNX16 antibody produced in rabbit (C15-1450-899)
Price: $879.43List Price: $977.14The gene SNX16 (sorting nexin 16) is mapped to human chromosome 8q21.13. -
Add to Cart The item has been addedHPA016707-100ULAnti-SP100 antibody produced in rabbit (C15-1448-579)
Price: $977.14List Price: $1,085.71Immunogen Nuclear autoantigen Sp-100 recombinant protein epitope signature tag (PrEST) Application Anti-SP100 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is -
Add to Cart The item has been addedHPA017384-100ULAnti-SP100 antibody produced in rabbit (C15-1448-766)
Price: $879.43List Price: $977.14Speckled protein of 100 kDa (Sp100), an interferon (IFN)-inducible acidic protein is considered as a component of the ND10 nuclear body. Sp100A, Sp100B, Sp100C and Sp100HMG are the four unique isoforms, expressed by human. -
Add to Cart The item has been addedHPA002866-100ULAnti-SSBP1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Single-stranded DNA-binding protein, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA006731-100ULAnti-USP10 antibody produced in rabbit (C15-1446-708)
Price: $879.43List Price: $977.14Immunogen Ubiquitin carboxyl-terminal hydrolase 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
