-
Add to Cart The item has been addedHPA069738-100ULAnti-EXO1 antibody produced in rabbit (C15-1465-738)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to exonuclease 1 Sequence LLREGKVSEARECFTRSINITHAMAHKVIKAARSQGVDCLVAPYEADAQLAYLNKAGIVQAIITEDSDLLAFGCKKVILKMDQFGNGLEIDQARLGMCR Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedHPA027438-100ULAnti-EXOC8 antibody produced in rabbit
Price: $879.43List Price: $977.14Exocyst complex component 8 (EXOC8) is part of the octameric exocyst complex, which has a role in targeting secretory vesicles to particular cell membrane domains. Immunogen Exocyst complex component 8 recombinant protein epitope signature tag -
Add to Cart The item has been addedHPA039702-100ULAnti-EXOSC8 antibody produced in rabbit (C15-1455-857)
Price: $928.29List Price: $1,031.43Immunogen exosome component 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA043942-100ULAnti-EXOSC8 antibody produced in rabbit (C15-1457-952)
Price: $928.29List Price: $1,031.43Immunogen exosome component 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA075230-100ULANTI-EXOSC8 ANTIBODY PRODUCED IN RABBIT (C15-1466-700)
Price: $977.14List Price: $1,085.71Immunogen exosome component 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA027103-100ULAnti-EYS antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen EGF-like-domain, multiple 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA077684-100ULAnti-EZH1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to enhancer of zeste 1 polycomb repressive complex 2 subunit Sequence YKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGRRRRRHHIVSASCSNASASAVAETKEGDSDRDTGNDWASSSSE Application All Prestige Antibodies Powered by -
Add to Cart The item has been addedHPA021616-100ULAnti-EZR antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Ezrin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA023954-100ULAnti-FAAP100 antibody produced in rabbit (C15-1450-577)
Price: $879.43List Price: $977.14The gene FAAP100 (Fanconi anemia core complex associated protein 100) is mapped to human chromosome 17q25. The protein is present in the nucleus. -
Add to Cart The item has been addedHPA026532-100ULAnti-FAAP100 antibody produced in rabbit (C15-1451-092)
Price: $879.43List Price: $977.14The gene FAAP100 (Fanconi anemia core complex associated protein 100) is mapped to human chromosome 17q25. The protein is present in the nucleus. -
Add to Cart The item has been addedHPA003902-100ULAnti-FAM118A antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Protein FAM118A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA001847-100ULAnti-FAM81A antibody produced in rabbit (C15-1445-439)
Price: $879.43List Price: $977.14Immunogen family with sequence similarity 81, member A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
