Rabbit epithelium allergenic extract

The gene GHRL (ghrelin) encodes a prepropeptide that cleaves to form two proteins ghrelin and obestatin. The gene is mapped to human chromosome 3p25-p26 containing four exons and three introns.

Immunogen chromosome 20 open reading frame 11 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen GID complex subunit 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen GINS complex subunit 3 (Psf3 homolog) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen GINS complex subunit 3 (Psf3 homolog) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Synthetic peptide directed towards the N terminal region of human GLI1 Application Anti-GLI1 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 &#956g/ml.

Immunogen GLI family zinc finger 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to GLI family zinc finger 1 Sequence PCLDFDSPTHSTGQLKAQLVCNYVQSQQELLWEGGGREDAPAQEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYP Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Immunogen glomulin, FKBP associated protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen glomulin, FKBP associated protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen guanine nucleotide binding protein (G protein), gamma 11 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the