Rabbit epithelium allergenic extract

Immunogen Synthetic peptide directed towards the N terminal region of human GRIK4 Application Anti-GRIK4 antibody produced in rabbit is suitable for western blotting at a concentration of 1 &#956g/ml. Biochem/physiol Actions GRIK4 or glutamate

Immunogen Recombinant protein corresponding to glutamate ionotropic receptor kainate type subunit 5 Sequence KVSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTY Application All Prestige Antibodies Powered by

Immunogen glutamate ionotropic receptor NMDA type subunit 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1 (glutamate binding) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1 (glutamate binding) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen glutamate receptor interacting protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen G protein-coupled receptor kinase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen G protein-coupled receptor kinase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

GRM1 is a metabotropic glutamate receptor that regulates the plasticity of the synapse and signaling pathways in the neurons. Genetic mutations in GRM1 have been associated with neuropsychiatric disorders and melanoma .

GRN (granulin) is a large cysteine rich glycoprotein, also called progranulin, which has a molecular weight of 88,000kDa. It is the largest member of granulin/epithelin family of growth factors.

Immunogen granulin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

The GrpE like 1, mitochondrial (GRPEL1) gene, also called human mitochondrial GrpE protein (HMGE), is mapped to human chromosome 4. It has N-terminal substrate binding domain.