Rabbit epithelium allergenic extract

Heat shock protein family A (Hsp70) member 5 (HSPA5), also known as glucose/regulated protein 78 (GRP78), is a stress-associated protein, encoded by the gene mapped to the long arm of human chromosome 9q33.3.

Immunogen heat shock 70kDa protein 7 (HSP70B) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Stress-70 protein, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Application Anti-HSPA9B antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project .

Immunogen Heat shock protein beta-8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen 60 kDa heat shock protein, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Application Anti-HSPD1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA)

Immunogen heat shock 60kDa protein 1 (chaperonin) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen heat shock 105kDa/110kDa protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen heat shock 105kDa/110kDa protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen histatin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to 5-hydroxytryptamine receptor 3A Sequence LRHLVLERIAWLLCLREQSTSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQELSSIRQFLEKRDEI Application All Prestige Antibodies Powered by Atlas Antibodies

Immunogen 5-hydroxytryptamine (serotonin) receptor 3B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen 5-hydroxytryptamine (serotonin) receptor 3E, ionotropic Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most