Rabbit epithelium allergenic extract

Immunogen inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Inhibitor of nuclear factor kappa-B kinase subunit epsilon recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen interleukin 1 receptor, type I Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen interleukin 1 receptor, type I Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen interleukin 4 receptor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to interleukin 9 receptor Sequence LTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen Recombinant protein corresponding to interleukin 9 receptor Sequence SNNNNYCALGCYGGWHLSALPGNTQSSGPIPALACGLSCDHQGLETQQGVAWVLAGHCQRPGLHEDLQGMLLPSVLSKARSWTF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen inhibitor of CDK, cyclin A1 interacting protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen inhibitor of CDK, cyclin A1 interacting protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen inhibitor of growth family, member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen inhibitor of growth family, member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

INHBE (Inhibin, &#946E) is a novel &#946 subunit of the dimeric glycoprotein, inhibins. It consists of an &#945-subunit and two possible &#946-subunits (&#946A or &#946B).