Rabbit epithelium allergenic extract

ITGA2B (integrin subunit &#9452b) is mapped to human chromosome 17q21.31.

ITGA2B (integrin subunit &#9452b) is mapped to human chromosome 17q21.31.

Integrin &#9453 (ITGA3) belongs to the integrin family. It is expressed in various parts of the developing kidney, like undifferentiated metanephric mesenchyme (MM), primary vesicles, S-shaped bodies and developing tubules.

Immunogen Recombinant protein corresponding to integrin subunit alpha 4 Sequence RLLYCIKADPHCLNFLCNFGKMESGKEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKR Application All Prestige Antibodies Powered by Atlas Antibodies are developed

ITGA5 (integrin subunit &#945 5) is a transmembrane glycoprotein. The protein has a large extracellular domain, a single spanning transmembrane domain and a short cytoplasmic domain.

Integrin &#945-6 (ITGA6) belongs to the integrin superfamily and is expressed in epithelial cells. The gene encoding it is present on chromosome 2q.

Immunogen integrin, alpha 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Integrin &#945-7 (ITGA7) is a laminin-binding integrin present in skeletal, smooth and heart muscles. The gene encoding the protein is present on chromosome 12q13.

Integrin &#945-8 (ITGA8) is a transmembrane protein. This protein is encoded by the ITGA8 gene in humans.

Anti-ITGAE antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues.

Immunogen integrin subunit alpha E Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Integrin alpha-V precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are