Rabbit epithelium allergenic extract

Integrin is an &#945&#946 heterodimeric adhesion receptor molecule. It consists of four domains in &#945-subunit and eight in the &#946-subunit.

Immunogen Recombinant protein corresponding to integrin subunit beta 1 binding protein 1 Sequence VSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLT Application All Prestige Antibodies Powered by Atlas Antibodies

Immunogen integrin beta 1 binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen Synthetic peptide directed towards the N terminal region of human ITGB1BP2 Biochem/physiol Actions ITGB1BP2 may play a role during maturation and/or organization of muscles cells. Sequence Synthetic peptide located within the following

Immunogen Integrin beta-2 precursor recombinant protein epitope signature tag (PrEST) Sequence CTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML Application All Prestige Antibodies

Immunogen Integrin beta-2 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Integrin subunit &#946 3 (ITGB3) is part of the integrin family whose members bind to proteins containing the arginine-glycine-aspartic acid (RGD)-motif. The ITGB3 protein is expressed in hematopoietic cells, endothelial cells, platelets and

Immunogen integrin &#946-3 binding protein (&#946-3-endonexin) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen integrin, beta 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen integrin, beta 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

&#921ntegrins, heterodimeric trans-membrane matrix receptors, are mainly involved in the signal transduction and attachments to extra cellular matrix (ECM).†† In ECM they act as a mediator of cell adhesion.

Integrin subunit &#946 6 (ITGB6) is a &#946 subunit of integrin &#945v&#9466, which is a membrane-spanning heterodimeric glycoprotein. It is encoded by the gene mapped to human chromosome 2q24.