-
Add to Cart The item has been addedHPA031686-100ULAnti-KYNU antibody produced in rabbit
Price: $889.20List Price: $988.00Immunogen kynureninase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA007256-100ULAnti-LAD1 antibody produced in rabbit (C15-1446-845)
Price: $879.43List Price: $977.14Immunogen Ladinin-1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA028732-100ULAnti-LAD1 antibody produced in rabbit (C15-1451-984)
Price: $879.43List Price: $977.14Immunogen ladinin 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA032110-100ULAnti-LAMA1 antibody produced in rabbit
Price: $889.20List Price: $988.00Immunogen laminin, alpha 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA015693-100ULAnti-LAMA4 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Laminin subunit alpha-4 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA020998-100ULAnti-LAMTOR4 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen UPF0539 protein C7orf59 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA034994-100ULAnti-LANCL1 antibody produced in rabbit
Price: $889.20List Price: $988.00Immunogen LanC lantibiotic synthetase component C-like 1 (bacterial) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA005470-100ULAnti-LANCL3 antibody produced in rabbit (C15-1446-362)
Price: $879.43List Price: $977.14LanC lantibiotic synthetase component C-like 3 (LANCL3) belongs to the LanC-like (LANCL) family of proteins, and shows similarity to lanthionine synthetase component C (LanC) proteins found in prokaryotes. In humans, there are three LANCL genes- -
Add to Cart The item has been addedHPA076575-100ULAnti-LANCL3 antibody produced in rabbit (C15-1466-910)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to LanC like 3 Sequence KLAQEVLTPAQIKSICQAILDSGKQYAIKKRKPFPLMYSYYGTEYLGAAHGLSSILQMLLSYHEHLKPSDRELVWQSVDFLMEQE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
Add to Cart The item has been addedHPA061463-100ULAnti-LAS1L antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen LAS1-like (S. cerevisiae) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA002461-100ULAnti-LAX1 antibody produced in rabbit (C15-1445-589)
Price: $879.43List Price: $977.14LAX (linker for activation of X cells) is a transmembrane adaptor protein that expressed in B cells, T cells, NK cells, mast cells, platelets and other lymphoid-specific cell types. It acts as a typical heavy raft" protein." -
Add to Cart The item has been addedHPA003887-100ULAnti-LAX1 antibody produced in rabbit (C15-1446-080)
Price: $879.43List Price: $977.14Immunogen Lymphocyte transmembrane adapter 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
