Rabbit epithelium allergenic extract

The gene LETM2 (leucine zipper and EF-hand containing transmembrane protein 2) is mapped to human chromosome 8. The function of it is currently unknown.

Immunogen LIM homeobox 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Lipoic acid synthetase (LIAS) a mitochondrial protein that catalyzes the synthesis of &#945-(+)-lipoic acid synthesis. Deficiency of LIAS is linked to glycine elevation, defects in mitochondrial energy metabolism and neonatal-onset epilepsy.

The gene LIAS (lipoyl synthase - mitochondrial) is mapped to human chromosome 4p14. The protein is mainly present in the mitochondria.

The gene Lipoyl synthase - mitochondrial (LIAS) is mapped to human chromosome 4p14. The protein is mainly present in the mitochondria.

The gene leukemia inhibitory factor (LIF) is mapped to human chromosome 22q12. It belongs to IL (Interleukin)-6 proinflammatory cytokine family.

Immunogen Synthetic peptide directed towards the middle region of human LIG1 Application Anti-LIG1 antibody produced in rabbit is suitable for western blotting at a concentration of 1&#956g/mL. Biochem/physiol Actions LIG1 gene encodes an enzyme

Immunogen ligase I, DNA, ATP-dependent Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen ligase I, DNA, ATP-dependent Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

LIG4 is a DNA Ligase IV is required for proper V(D)J recombination and DNA double-strand break (DSB) repair through nonhomologous end joining (NHEJ). It forms a complex with XRCC4.

Immunogen DNA ligase 4 recombinant protein epitope signature tag (PrEST) Application Anti-LIG4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by

Immunogen Recombinant protein corresponding to DNA ligase 4 Sequence PQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTPTGTHGDAGDFAMIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHNV Application All Prestige