-
Add to Cart The item has been addedHPA023871-100ULAnti-LIMA1 antibody produced in rabbit (C15-1450-530)
Price: $879.43List Price: $977.14Immunogen LIM domain and actin-binding protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA052645-100ULAnti-LIMA1 antibody produced in rabbit (C15-1461-086)
Price: $928.29List Price: $1,031.43Immunogen LIM domain and actin binding 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA004184-100ULAnti-LIMCH1 antibody produced in rabbit (C15-1446-185)
Price: $879.43List Price: $977.14LIMCH1 belongs to the human mosaic domain superfamily. It is multidomain molecule composed of calponin homology (CH) domain that acts as actin binding domain and the conserved cysteine rich double Zn finger possessing Lim domain. -
Add to Cart The item has been addedHPA063840-100ULAnti-LIMCH1 antibody produced in rabbit (C15-1464-497)
Price: $928.29List Price: $1,031.43Immunogen LIM and calponin homology domains 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA064220-100ULAnti-LIMD1 antibody produced in rabbit (C15-1464-584)
Price: $928.29List Price: $1,031.43Immunogen LIM domains containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA071736-100ULANTI-LIMD1 ANTIBODY PRODUCED IN RABBIT (C15-1466-091)
Price: $977.14List Price: $1,085.71Immunogen LIM domains containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA063074-100ULANTI-LIN28A ANTIBODY PRODUCED IN RABBIT (C15-1464-273)
Price: $977.14List Price: $1,085.71Immunogen lin-28 homolog A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA068814-100ULANTI-LIN28A ANTIBODY PRODUCED IN RABBIT (C15-1465-550)
Price: $977.14List Price: $1,085.71Immunogen lin-28 homolog A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA036630-100ULAnti-LIN28B antibody produced in rabbit (C15-1454-454)
Price: $928.29List Price: $1,031.43Lin-28 homolog B (LIN28B) is expressed in embryonic stem cells. The gene encoding it is localized on human chromosome 6q21 and consists of seven exons. -
Add to Cart The item has been addedHPA061745-100ULAnti-LIN28B antibody produced in rabbit (C15-1463-898)
Price: $928.29List Price: $1,031.43Immunogen lin-28 homolog B (C. elegans) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA071562-100ULAnti-LIN7A antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to lin-7 homolog A, crumbs cell polarity complex component Sequence EVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKVFSCV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedHPA051118-100ULAnti-LIN7C antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen lin-7 homolog C (C. elegans) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
