-
Add to Cart The item has been addedHPA061162-100ULAnti-LONRF3 antibody produced in rabbit (C15-1463-710)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to LON peptidase N-terminal domain and ring finger 3 Sequence MESVRIEQMLSLPAEVSSDNLESAERGASAAQVDMGPHPKVAAEGPAPLPTREPEQEQSPGTSTPESKVLLTQ Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA043930-100ULAnti-LOX antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen lysyl oxidase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA077128-100ULANTI-LOXHD1 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen lipoxygenase homology domains 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA060604-100ULAnti-LPA antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen lipoprotein, Lp(a) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA019616-100ULAnti-LPAR2 antibody produced in rabbit
Price: $879.43List Price: $977.14LPAR2 (Lysophosphatidic acid receptor 2) is a bioactive lysophospholipid belonging to the endothelial cell differentiation gene (EDG) family of GPCRs. It is widely expressed in different tissues and cell types. -
Add to Cart The item has been addedHPA043741-100ULAnti-LPXN antibody produced in rabbit (C15-1457-850)
Price: $928.29List Price: $1,031.43Immunogen leupaxin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA061441-100ULAnti-LPXN antibody produced in rabbit (C15-1463-797)
Price: $928.29List Price: $1,031.43Immunogen leupaxin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
Add to Cart The item has been addedHPA019366-100ULAnti-LRBA antibody produced in rabbit (C15-1449-296)
Price: $977.14List Price: $1,085.71Lrba consists of a BEACH domain situated between a PH-like domain and WD-40 domain. The gene LRBA (lipopolysaccharide-responsive and beige-like anchor protein) is mapped to human chromosome 4q31. -
Add to Cart The item has been addedHPA023597-100ULAnti-LRBA antibody produced in rabbit (C15-1450-451)
Price: $977.14List Price: $1,085.71The gene LRBA (lipopolysaccharide-responsive and beige-like anchor protein) is mapped to human chromosome 4q31.3. -
Add to Cart The item has been addedHPA037667-100ULAnti-LRCH4 antibody produced in rabbit (C15-1454-833)
Price: $928.29List Price: $1,031.43Immunogen leucine-rich repeats and calponin homology (CH) domain containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA037668-100ULAnti-LRCH4 antibody produced in rabbit (C15-1454-834)
Price: $928.29List Price: $1,031.43Immunogen leucine-rich repeats and calponin homology (CH) domain containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA076660-100ULAnti-LRFN2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen leucine rich repeat and fibronectin type III domain containing 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the
