-
HPA035451-100UL
Anti-MRPS18A antibody produced in rabbit (C15-1453-865)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein S18A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA043485-100UL
Anti-MRPS18B antibody produced in rabbit (C15-1457-712)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein S18B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA050334-100UL
Anti-MRPS18B antibody produced in rabbit (C15-1460-260)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein S18B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA030425-100UL
Anti-MRPS33 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen mitochondrial ribosomal protein S33 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA043476-100UL
Anti-MRPS9 antibody produced in rabbit (C15-1457-704)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein S9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA048479-100UL
Anti-MRPS9 antibody produced in rabbit (C15-1459-597)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein S9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA047177-100UL
Anti-MRRF antibody produced in rabbit (C15-1459-162)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosome recycling factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA049987-100UL
Anti-MRRF antibody produced in rabbit (C15-1460-162)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosome recycling factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA029323-100UL
Anti-MS4A4A antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen membrane-spanning 4-domains, subfamily A, member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA040075-100UL
Anti-MS4A4E antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen membrane-spanning 4-domains, subfamily A, member 4E recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA007318-100UL
Anti-MS4A8 antibody produced in rabbit (C15-1446-869)
Price: $879.43List Price: $977.14Immunogen Membrane-spanning 4-domains subfamily A member 8B recombinant protein epitope signature tag (PrEST) Sequence MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGK Application All Prestige Antibodies Powered by Atlas -
HPA007319-100UL
Anti-MS4A8 antibody produced in rabbit (C15-1446-870)
Price: $879.43List Price: $977.14MS4A8 (membrane-spanning 4-domains, subfamily A, member 8) gene encodes a protein belonging to the MS4A family of proteins that are characterized by common structural features and similar intron/exon splice boundaries. Their expression pattern is