-
HPA038437-100UL
Anti-MYOZ1 antibody produced in rabbit (C15-1455-245)
Price: $928.29List Price: $1,031.43Immunogen myozenin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA060245-100UL
Anti-MYT1L antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to myelin transcription factor 1 like Sequence VNSDRSEEVFDMTKGNLTLLEKAIALETERAKAMREKMAMEAGRRDNMRSYEDQSPRQLPGEDRKPKSSDSHVK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA037816-100UL
Anti-NAA40 antibody produced in rabbit (C15-1454-921)
Price: $928.29List Price: $1,031.43Immunogen N(alpha)-acetyltransferase 40, NatD catalytic subunit, homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
HPA056142-100UL
ANTI-NAA40 ANTIBODY PRODUCED IN RABBIT (C15-1462-259)
Price: $977.14List Price: $1,085.71Immunogen N(alpha)-acetyltransferase 40, NatD catalytic subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA000649-100UL
Anti-NAGA antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen α-N-Acetylgalactosaminidase precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA027300-100UL
Anti-NAGS antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen N-acetylglutamate synthase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA057576-100UL
Anti-NAT10 antibody produced in rabbit (C15-1462-700)
Price: $928.29List Price: $1,031.43Immunogen N-acetyltransferase 10 (GCN5-related) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA071628-100UL
Anti-NAT10 antibody produced in rabbit (C15-1466-075)
Price: $928.29List Price: $1,031.43Immunogen N-acetyltransferase 10 (GCN5-related) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA040677-100UL
Anti-NAT8L antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen N-acetyltransferase 8-like (GCN5-related, putative) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA021820-100UL
Anti-NAT9 antibody produced in rabbit (C15-1450-006)
Price: $879.43List Price: $977.14Immunogen N-acetyltransferase 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA057149-100UL
Anti-NAT9 antibody produced in rabbit (C15-1462-568)
Price: $928.29List Price: $1,031.43Immunogen N-acetyltransferase 9 (GCN5-related, putative) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA049189-100UL
Anti-NBEAL1 antibody produced in rabbit (C15-1459-856)
Price: $928.29List Price: $1,031.43Immunogen neurobeachin-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the