Rabbit epithelium allergenic extract

Immunogen neurobeachin-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Norrin precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

NDST4 (N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4) is the fourth member of NDST family, and shows high sequence homology to the other three members namely, NDST1, NDST2 and NDST3. It is made of 872 amino acids.

Immunogen NADH dehydrogenase (ubiquinone) 1&#946-subcomplex subunit 8, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen NADH:ubiquinone oxidoreductase subunit B8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

The gene NDUFS8 (NADH dehydrogenase [ubiquinone] iron-sulfur protein 8 - mitochondrial) is mapped to human chromosome 11q13. It is a nuclear encoded gene and is localized in the mitochondria.

Immunogen NADH:ubiquinone oxidoreductase core subunit S8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to neural precursor cell expressed, developmentally down-regulated 8 Sequence TLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVL Application All Prestige Antibodies Powered by Atlas Antibodies

Immunogen Recombinant protein corresponding to neural precursor cell expressed, developmentally down-regulated 8 Sequence MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen Serine/threonine-protein kinase Nek9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Neuroepithelial cell transforming 1 (NET1) is a guanine nucleotide exchange factor which is specific to the RhoA-subfamily. Immunogen neuroepithelial cell transforming 1 recombinant protein epitope signature tag (PrEST) Application All Prestige

Immunogen neuropilin (NRP) and tolloid (TLL)-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive