Rabbit epithelium allergenic extract

OAS1 (2&#8242-5&#8242-oligoadenylate synthetase 1, 40/46kDa) is an interferon-inducible protein beloonging to the 2&#8242-5&#8242-Oligoadenylate synthetase family. It plays an essential role in host defense system against viral infection.

Immunogen 2&#8242-5&#8242-oligoadenylate synthetase 3, 100kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen 2&#8242-5&#8242-oligoadenylate synthetase 3, 100kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen 59 kDa 2&#8242&#85945&#8242-Oligoadenylate synthetase-like protein recombinant protein epitope signature tag (PrEST) Application Anti-OASL antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human

Occludin (OCLN) is an important membrane protein that is localized in the tight junction (TJ). This protein is made up of four transmembrane proteins, a short N-terminal cytoplasmic domain, two extracellular loops, one intracellular turn, and a

Immunogen Transmembrane protein C20orf123 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

The outer dense fiber of sperm tails 2 (ODF2) gene is located on the human chromosome at 9q34.11.

Outer dense fiber of sperm tails 2 (ODF2) possesses two carboxy-terminal leucine zippers. This 70-73 kDa protein is part of the sperm tail cytoskeleton and the centrosomal scaffold which associates with mother centrioles in somatic cells.

Immunogen orofacial cleft 1 candidate 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to orofacial cleft 1 candidate 1 Sequence SVKGKSTVWRIGEAEDYSQDISYLEELEEHRFSVCCSSVADSRYGDFFKHLHFVLVSASSELQLSQW Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen oral-facial-digital syndrome 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen oral-facial-digital syndrome 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are