-
Add to Cart The item has been addedHPA031104-100ULAnti-OFD1 antibody produced in rabbit (C15-1452-983)
Price: $889.20List Price: $988.00Immunogen oral-facial-digital syndrome 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA013132-100ULAnti-OGN antibody produced in rabbit
Price: $879.43List Price: $977.14Osteoglycin (OGN) is a 22-28kDa glycoprotein which is present in the bone matrix. It is heavily glycosylated. -
Add to Cart The item has been addedHPA030751-100ULAnti-OGT antibody produced in rabbit (C15-1452-820)
Price: $879.43List Price: $977.14OGT (O-linked N-acetylglucosamine transferase) gene is mapped to human chromosome Xq13.1. -
Add to Cart The item has been addedHPA030752-100ULAnti-OGT antibody produced in rabbit (C15-1452-821)
Price: $879.43List Price: $977.14The gene OGT ( O -linked N -acetylglucosamine (GlcNAc) transferase) is mapped to human chromosome Xq13.1. -
Add to Cart The item has been addedHPA030753-100ULAnti-OGT antibody produced in rabbit (C15-1452-822)
Price: $879.43List Price: $977.14Immunogen O-linked N-acetylglucosamine (GlcNAc) transferase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA030754-100ULAnti-OGT antibody produced in rabbit (C15-1452-824)
Price: $879.43List Price: $977.14Immunogen O-linked N-acetylglucosamine (GlcNAc) transferase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAV45322-100ULAnti-OLR1 antibody produced in rabbit (C15-1341-535)
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the N terminal region of human OLR1 Application Anti-OLR1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml. -
Add to Cart The item has been addedHPA050798-100ULAnti-OLR1 antibody produced in rabbit (C15-1460-417)
Price: $977.14List Price: $1,085.71Immunogen oxidized low density lipoprotein (lectin-like) receptor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA069948-100ULAnti-OMD antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to osteomodulin Sequence PGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA008206-100ULAnti-OMG antibody produced in rabbit (C15-1447-077)
Price: $879.43List Price: $977.14Immunogen Oligodendrocyte-myelin glycoprotein precursor recombinant protein epitope signature tag (PrEST) Sequence -
Add to Cart The item has been addedHPA012693-100ULAnti-OMG antibody produced in rabbit (C15-1447-834)
Price: $879.43List Price: $977.14The gene encoding oligodendrocyte-myelin glycoprotein (OMG) occupies 2.7kb of genomic DNA. -
Add to Cart The item has been addedHPA003457-100ULAnti-ONECUT1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Hepatocyte nuclear factor 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
