-
Add to Cart The item has been addedHPA041875-100ULAnti-PAF1 antibody produced in rabbit (C15-1456-936)
Price: $928.29List Price: $1,031.43Immunogen Paf1, RNA polymerase II associated factor, homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA043637-100ULAnti-PAF1 antibody produced in rabbit (C15-1457-798)
Price: $928.29List Price: $1,031.43Immunogen PAF1 homolog, Paf1/RNA polymerase II complex component Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA051836-100ULAnti-PAFAH1B2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedHPA035639-100ULAnti-PAFAH1B3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedHPA023880-100ULAnti-PAGE4 antibody produced in rabbit
Price: $879.43List Price: $977.14Prostate-associated Gene 4 (PAGE4) is mapped to human chromosome Xp11.21. -
Add to Cart The item has been addedHPA041440-100ULAnti-PAGR1 antibody produced in rabbit (C15-1456-700)
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 53 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA043608-100ULAnti-PAGR1 antibody produced in rabbit (C15-1457-783)
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 53 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA035895-100ULAnti-PAICS antibody produced in rabbit (C15-1454-077)
Price: $928.29List Price: $1,031.43Immunogen phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedHPA041538-100ULAnti-PAICS antibody produced in rabbit (C15-1456-753)
Price: $928.29List Price: $1,031.43Immunogen phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
Add to Cart The item has been addedHPA003565-100ULAnti-PAK1 antibody produced in rabbit
Price: $879.43List Price: $977.14PAK1 (p21 activated kinase 1) is a Ser/Thr kinase protein, and is a member of the evolutional conserved PAKs, which consists of six members. PAKs are divided into two groups- group I and II. -
Add to Cart The item has been addedHPA030111-100ULAnti-PAK1IP1 antibody produced in rabbit (C15-1452-537)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to PAK1 interacting protein 1 Sequence GTITNEKRISSVKFLSESVLAVAGDEEVIRFFDCDSLVCLCEFKAHENRVKDMISFEIPEHHVIVSASSDGFIKMWK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedHPA030112-100ULAnti-PAK1IP1 antibody produced in rabbit (C15-1452-538)
Price: $879.43List Price: $977.14Immunogen PAK1 interacting protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
