-
Add to Cart The item has been addedHPA012010-100ULAnti-PARN antibody produced in rabbit (C15-1447-706)
Price: $879.43List Price: $977.14Immunogen Poly(A)-specific ribonuclease PARN recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedAV33754-100ULAnti-PARP1 antibody produced in rabbit (C15-1340-834)
Price: $694.29List Price: $771.43Immunogen Synthetic peptide directed towards the C terminal region of human PARP1 Biochem/physiol Actions PARP1 encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. -
Add to Cart The item has been addedHPA045168-100ULAnti-PARP1 antibody produced in rabbit (C15-1458-432)
Price: $977.14List Price: $1,085.71Immunogen poly (ADP-ribose) polymerase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA028122-100ULAnti-PARP10 antibody produced in rabbit (C15-1451-718)
Price: $879.43List Price: $977.14Immunogen poly (ADP-ribose) polymerase family, member 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA052427-100ULAnti-PARP10 antibody produced in rabbit (C15-1461-013)
Price: $928.29List Price: $1,031.43Immunogen poly (ADP-ribose) polymerase family, member 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAV33768-100ULAnti-PARP11 antibody produced in rabbit (C15-1340-836)
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human PARP11 Biochem/physiol Actions The PARP11 gene is part of the poly (ADP-ribose) polymerase family. Sequence Synthetic peptide located within the following region: -
Add to Cart The item has been addedHPA026895-100ULAnti-PARP11 antibody produced in rabbit (C15-1451-257)
Price: $879.43List Price: $977.14Immunogen Poly recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA008846-100ULAnti-PARP14 antibody produced in rabbit (C15-1447-235)
Price: $879.43List Price: $977.14Immunogen Poly [ADP-ribose] polymerase 14 recombinant protein epitope signature tag (PrEST) Sequence RYFLLCHSSLLDHLLTECPEIEICYDRVTQHLCLKGPSADVYKAKCEIQEKVYTMAQKNIQVSPEIFQFLQQVNWKEFSKCLFIAQKILALYELEGTTVLLTSCSSEALL Application All Prestige Antibodies -
Add to Cart The item has been addedHPA012063-100ULAnti-PARP14 antibody produced in rabbit (C15-1447-724)
Price: $879.43List Price: $977.14Poly(ADP-ribose) polymerase family member 14 (PARP14) is a nuclear protein encoded by the gene mapped to human chromosome 3q21.1. -
Add to Cart The item has been addedHPA052003-100ULAnti-PARP2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen poly (ADP-ribose) polymerase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA020984-100ULANTI-PARP3 ANTIBODY PRODUCED IN RABBIT (C15-1449-713)
Price: $977.14List Price: $1,085.71Immunogen poly(ADP-ribose) polymerase family member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA067657-100ULAnti-PARP3 antibody produced in rabbit (C15-1465-351)
Price: $928.29List Price: $1,031.43Immunogen poly (ADP-ribose) polymerase family, member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
