-
Add to Cart The item has been addedHPA022539-100ULAnti-PECR antibody produced in rabbit (C15-1450-131)
Price: $879.43List Price: $977.14Peroxisomal trans-2- enoyl-CoA reductase (PECR) is an enzyme located on the chromosome region 2q35. The carboxyl end contains PTS-1 (Peroxisomal Targeting Signal Type 1) and AKL. -
Add to Cart The item has been addedHPA053966-100ULAnti-PELP1 antibody produced in rabbit (C15-1461-513)
Price: $928.29List Price: $1,031.43Immunogen proline, glutamate and leucine rich protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA056028-100ULAnti-PELP1 antibody produced in rabbit (C15-1462-221)
Price: $928.29List Price: $1,031.43Immunogen proline, glutamate and leucine rich protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA060760-100ULAnti-PELP1 antibody produced in rabbit (C15-1463-616)
Price: $928.29List Price: $1,031.43Immunogen proline, glutamate and leucine rich protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA067064-100ULAnti-PER1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen period circadian clock 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA053136-100ULANTI-PER2 ANTIBODY PRODUCED IN RABBIT (C15-1461-242)
Price: $977.14List Price: $1,085.71Immunogen period circadian regulator 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA060510-100ULAnti-PER2 antibody produced in rabbit (C15-1463-555)
Price: $928.29List Price: $1,031.43Immunogen period circadian clock 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA019530-100ULAnti-PER3 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Period circadian protein homolog 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA031711-100ULAnti-PERM1 antibody produced in rabbit (C15-1453-235)
Price: $977.14List Price: $1,085.71PERM1 (PPARGC1(Peroxisome proliferator-activated receptor γ coactivator 1-α) and ESRR induced regulator, muscle 1) codes for PGC-1 (proliferator-activated receptor γ coactivator 1)/ERR (estrogen-related receptor)-induced regulator in -
Add to Cart The item has been addedHPA031712-100ULAnti-PERM1 antibody produced in rabbit (C15-1453-236)
Price: $889.20List Price: $988.00PGC-1/ERR-induced regulator in muscle 1 (PERM1), a cytoplasmic protein is coded by Perm1 gene. It is present in multiple cellular compartments and is expressed in muscle. -
Add to Cart The item has been addedHPA067288-100ULAnti-PET100 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to PET100 homolog Sequence ELWPPEKLQEIEEFKERLRKRREEKLLRDAQQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA020235-100ULAnti-PEX1 antibody produced in rabbit
Price: $879.43List Price: $977.14Peroxisomal biogenesis factor 1 (PEX1) belongs to the ATPases associated with diverse cellular activities (AAA) family of proteins and possesses two ATPase domains. It has a molecular weight of 147kDa.
