Rabbit epithelium allergenic extract

PITRM1 (Pitrilysin metallopeptidase 1) is a metalloendoprotease belonging to the pitrilysin family. It comprises of a conserved catalytic domain at the N-terminal region.

PITRM1 (Pitrilysin metallopeptidase 1) is a metalloendoprotease belonging to the pitrilysin family. It comprises of a conserved catalytic domain at the N-terminal region.

Immunogen E3 ubiquitin-protein ligase Praja1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen polycystic kidney and hepatic disease 1 (autosomal recessive) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen protein kinase (cAMP-dependent, catalytic) inhibitor beta recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen protein kinase (cAMP-dependent, catalytic) inhibitor gamma recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen protein kinase (cAMP-dependent, catalytic) inhibitor gamma Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen pyruvate kinase, muscle recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen Serine/threonine-protein kinase N1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen protein kinase N2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen Recombinant protein corresponding to protein kinase N2 Sequence ASSLGEIDESSELRVLDIPGQDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen protein kinase N3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.